Lineage for d2ovlb1 (2ovl B:3-129)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649720Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries)
  8. 1649726Domain d2ovlb1: 2ovl B:3-129 [243394]
    Other proteins in same PDB: d2ovla2, d2ovlb2, d2ovlc2, d2ovld2
    automated match to d3bjsa1
    complexed with na

Details for d2ovlb1

PDB Entry: 2ovl (more details), 2.13 Å

PDB Description: Crystal structure of a racemase from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) Putative racemase

SCOPe Domain Sequences for d2ovlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovlb1 d.54.1.0 (B:3-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
lwklfgg

SCOPe Domain Coordinates for d2ovlb1:

Click to download the PDB-style file with coordinates for d2ovlb1.
(The format of our PDB-style files is described here.)

Timeline for d2ovlb1: