| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (94 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:100226] [231094] (3 PDB entries) |
| Domain d2ovla1: 2ovl A:4-129 [243392] Other proteins in same PDB: d2ovla2, d2ovla3, d2ovlb2, d2ovlb3, d2ovlc2, d2ovlc3, d2ovld2, d2ovld3 automated match to d3bjsa1 complexed with na |
PDB Entry: 2ovl (more details), 2.13 Å
SCOPe Domain Sequences for d2ovla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ovla1 d.54.1.0 (A:4-129) automated matches {Streptomyces coelicolor [TaxId: 100226]}
iervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavatm
vdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartpl
wklfgg
Timeline for d2ovla1: