SCOPe 2.08: Domain d2ouya1: 2ouy A:449-776

Lineage for d2ouya1 (2ouy A:449-776)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d2ouya1: 2ouy A:449-776 [243390]
   Other proteins in same PDB: d2ouya2, d2ouyb2
   automated match to d2ouva_
   complexed with cmp, mg, zn; mutant

Details for d2ouya1

PDB Entry: 2ouy, 1.9 Å

PDB Description: crystal structure of pde10a2 mutant d564a in complex with camp.

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ouya1:

Sequence; same for both SEQRES and ATOM records:

>d2ouya1 a.211.1.0 (A:449-776) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchnldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeetatwis

Timeline for d2ouya1:

• d2ouya1 first appeared in SCOPe 2.04, called d2ouya_
  
• d2ouya1 appears in SCOPe 2.07