SCOP 1.69: Domain d1ukrd_: 1ukr D:

Lineage for d1ukrd_ (1ukr D:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Aspergillus niger [49987] (1 PDB entry)

8. Domain d1ukrd_: 1ukr D: [24339]

Details for d1ukrd_

PDB Entry: 1ukr, 2.4 Å

PDB Description: structure of endo-1,4-beta-xylanase c

SCOP Domain Sequences for d1ukrd_:

Sequence; same for both SEQRES and ATOM records:

>d1ukrd_ b.29.1.11 (D:) Xylanase II {Aspergillus niger}
ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
s

Timeline for d1ukrd_:

• d1ukrd_ first appeared (with stable ids) in SCOP 1.55
  
• d1ukrd_ appears in SCOP 1.67
  
• d1ukrd_ appears in SCOP 1.71
  
• d1ukrd_ appears in the current release, SCOPe 2.08