SCOPe 2.04: Domain d2ouua_: 2ouu A:

Lineage for d2ouua_ (2ouu A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)

8. Domain d2ouua_: 2ouu A: [243388]
   automated match to d2ourb_
   complexed with 35g, mg; mutant

Details for d2ouua_

PDB Entry: 2ouu, 1.52 Å

PDB Description: crystal structure of pde10a2 mutant d674a in complex with cgmp

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ouua_:

Sequence; same for both SEQRES and ATOM records:

>d2ouua_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvt
kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
pptepllkacrdnlsqwekvirgeetatw

Timeline for d2ouua_:

• d2ouua_ is new in SCOPe 2.04-stable
  
• d2ouua_ appears in SCOPe 2.05
  
• d2ouua_ appears in the current release, SCOPe 2.08, called d2ouua1