Lineage for d2ouua1 (2ouu A:449-774)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737208Domain d2ouua1: 2ouu A:449-774 [243388]
    Other proteins in same PDB: d2ouua2, d2ouub2
    automated match to d2ourb_
    complexed with 35g, mg; mutant

Details for d2ouua1

PDB Entry: 2ouu (more details), 1.52 Å

PDB Description: crystal structure of pde10a2 mutant d674a in complex with cgmp
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ouua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouua1 a.211.1.0 (A:449-774) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeetatw

SCOPe Domain Coordinates for d2ouua1:

Click to download the PDB-style file with coordinates for d2ouua1.
(The format of our PDB-style files is described here.)

Timeline for d2ouua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ouua2