SCOPe 2.05: Domain d2ousb_: 2ous B:

Lineage for d2ousb_ (2ous B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d2ousb_: 2ous B: [243387]
   automated match to d2ourb_
   complexed with mg; mutant

Details for d2ousb_

PDB Entry: 2ous, 1.45 Å

PDB Description: crystal structure of pde10a2 mutant d674a

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2ousb_:

Sequence; same for both SEQRES and ATOM records:

>d2ousb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacalcsvtklwpvt
kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
pptepllkacrdnlsqwekvirgeetatw

Timeline for d2ousb_:

• d2ousb_ first appeared in SCOPe 2.04
  
• d2ousb_ is called d2ousb1 in SCOPe 2.06
  
• d2ousb_ appears in the current release, SCOPe 2.08, called d2ousb1