SCOPe 2.04: Domain d2oupb_: 2oup B:

Lineage for d2oupb_ (2oup B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)

8. Domain d2oupb_: 2oup B: [243383]
   automated match to d2ouna_
   complexed with mg, zn

Details for d2oupb_

PDB Entry: 2oup, 1.56 Å

PDB Description: crystal structure of PDE10A

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d2oupb_:

Sequence; same for both SEQRES and ATOM records:

>d2oupb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvt
kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
pptepllkacrdnlsqwekvirgee

Timeline for d2oupb_:

• d2oupb_ is new in SCOPe 2.04-stable
  
• d2oupb_ appears in SCOPe 2.05
  
• d2oupb_ appears in the current release, SCOPe 2.08, called d2oupb1