SCOPe 2.05: Domain d2ou7a_: 2ou7 A:

Lineage for d2ou7a_ (2ou7 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)

8. Domain d2ou7a_: 2ou7 A: [243381]
   automated match to d2rkua_
   complexed with act, anp, mg, zn

Details for d2ou7a_

PDB Entry: 2ou7, 2.4 Å

PDB Description: structure of the catalytic domain of human polo-like kinase 1

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d2ou7a_:

Sequence; same for both SEQRES and ATOM records:

>d2ou7a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akeipevlvdprsrrryvrgrflgkggfakcfeisdadtkevfagkivpkslllkphqre
kmsmeisihrslahqhvvgfhgffedndfvfvvlelcrrrsllelhkrrkaltepearyy
lrqivlgcqylhrnrvihrdlklgnlflnedlevkigdfglatkveydgerkkvlcgtpn
yiapevlskkghsfevdvwsigcimytllvgkppfetsclketylrikkneysipkhinp
vaasliqkmlqtdptarptinellndefftsgyiparlpitcltipprfsia

Timeline for d2ou7a_:

• d2ou7a_ first appeared in SCOPe 2.04
  
• d2ou7a_ appears in SCOPe 2.06
  
• d2ou7a_ appears in the current release, SCOPe 2.08