Lineage for d2otkf_ (2otk F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2697064Protein automated matches [191290] (5 species)
    not a true protein
  7. 2697067Species Engineered binding [255533] (1 PDB entry)
  8. 2697069Domain d2otkf_: 2otk F: [243379]
    automated match to d1ss1a_

Details for d2otkf_

PDB Entry: 2otk (more details)

PDB Description: structure of alzheimer ab peptide in complex with an engineered binding protein
PDB Compounds: (F:) ZAb3 Affibody dimer

SCOPe Domain Sequences for d2otkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otkf_ a.8.1.1 (F:) automated matches {Engineered binding}
geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa

SCOPe Domain Coordinates for d2otkf_:

Click to download the PDB-style file with coordinates for d2otkf_.
(The format of our PDB-style files is described here.)

Timeline for d2otkf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otke_