Lineage for d2otgc_ (2otg C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324958Species Placopecten magellanicus [TaxId:6577] [255532] (1 PDB entry)
  8. 2324960Domain d2otgc_: 2otg C: [243377]
    automated match to d1br1b_
    complexed with adp, ca, mg

Details for d2otgc_

PDB Entry: 2otg (more details), 3.12 Å

PDB Description: Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
PDB Compounds: (C:) myosin essential light chain

SCOPe Domain Sequences for d2otgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otgc_ a.39.1.0 (C:) automated matches {Placopecten magellanicus [TaxId: 6577]}
pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde
evdeiinltdlqedlegnvkyeefvkkvmtgpypd

SCOPe Domain Coordinates for d2otgc_:

Click to download the PDB-style file with coordinates for d2otgc_.
(The format of our PDB-style files is described here.)

Timeline for d2otgc_: