![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Placopecten magellanicus [TaxId:6577] [255532] (1 PDB entry) |
![]() | Domain d2otgc_: 2otg C: [243377] automated match to d1br1b_ complexed with adp, ca, mg |
PDB Entry: 2otg (more details), 3.12 Å
SCOPe Domain Sequences for d2otgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otgc_ a.39.1.0 (C:) automated matches {Placopecten magellanicus [TaxId: 6577]} pklsqdeiddlkevfelfdfwdgrdgavdafkigdvcrclginprnedvfavggthkmge kslpfeeflpayeglmdceqgtyadymeafktfdregqgfisgaelrhvlsglgerlsde evdeiinltdlqedlegnvkyeefvkkvmtgpypd
Timeline for d2otgc_: