SCOPe 2.08: Domain d2otgb_: 2otg B:

Lineage for d2otgb_ (2otg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Placopecten magellanicus [TaxId:6577] [255532] (1 PDB entry)

8. Domain d2otgb_: 2otg B: [243376]
   automated match to d2mysb_
   complexed with adp, ca, mg

Details for d2otgb_

PDB Entry: 2otg, 3.12 Å

PDB Description: Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor

PDB Compounds: (B:) myosin regulatory light chain

SCOPe Domain Sequences for d2otgb_:

Sequence; same for both SEQRES and ATOM records:

>d2otgb_ a.39.1.0 (B:) automated matches {Placopecten magellanicus [TaxId: 6577]}
pqkqiqemkeaftmidqnrdgfidindlkemfsslgrtpddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafgmfdeldtkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvrfvamikgsgd

Timeline for d2otgb_:

• d2otgb_ first appeared in SCOPe 2.04
  
• d2otgb_ appears in SCOPe 2.07