Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
Protein B1 domain of neuropilin-1 [82016] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256384] (1 PDB entry) |
Domain d2orxa2: 2orx A:427-586 [243375] automated match to d1sddb4 |
PDB Entry: 2orx (more details), 2.4 Å
SCOPe Domain Sequences for d2orxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2orxa2 b.18.1.2 (A:427-586) B1 domain of neuropilin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} tdypcsgmlgmvsglisdsqitasnqgdrnwmpenirlvtsrtgwalppsphpyinewlq vdlgdekivrgviiqggkhrenkvfmrkfkiaysnngsdwkmimddskrkaksfegnnny dtpelraftplstrfiriyperathsglglrmellgceve
Timeline for d2orxa2: