SCOPe 2.07: Domain d2orxa1: 2orx A:273-426

Lineage for d2orxa1 (2orx A:273-426)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
   automatically mapped to Pfam PF00754

6. Protein B1 domain of neuropilin-1 [82016] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256384] (1 PDB entry)

8. Domain d2orxa1: 2orx A:273-426 [243374]
   automated match to d1sddb4

Details for d2orxa1

PDB Entry: 2orx, 2.4 Å

PDB Description: Structural Basis for Ligand Binding and Heparin Mediated Activation of Neuropilin

PDB Compounds: (A:) Neuropilin-1

SCOPe Domain Sequences for d2orxa1:

Sequence; same for both SEQRES and ATOM records:

>d2orxa1 b.18.1.2 (A:273-426) B1 domain of neuropilin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fkcmealgmesgeihsdqitassqygtnwsversrlnypengwtpgedsyrewiqvdlgl
lrfvtavgtqgaisketkkkyyvktyrvdissngedwitlkegnkaiifqgntnptdvvf
gvfpkplitrfvrikpaswetgismrfevygcki

Timeline for d2orxa1:

• d2orxa1 first appeared in SCOPe 2.04
  
• d2orxa1 appears in SCOPe 2.06
  
• d2orxa1 appears in the current release, SCOPe 2.08