SCOPe 2.04: Domain d2oqyh2: 2oqy H:123-374

Lineage for d2oqyh2 (2oqy H:123-374)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:182710] [255531] (1 PDB entry)

8. Domain d2oqyh2: 2oqy H:123-374 [243373]
   Other proteins in same PDB: d2oqya1, d2oqyb1, d2oqyc1, d2oqyd1, d2oqye1, d2oqyf1, d2oqyg1, d2oqyh1
   automated match to d3sjna2
   complexed with mg

Details for d2oqyh2

PDB Entry: 2oqy, 2 Å

PDB Description: the crystal structure of muconate cycloisomerase from oceanobacillus iheyensis

PDB Compounds: (H:) Muconate cycloisomerase

SCOPe Domain Sequences for d2oqyh2:

Sequence; same for both SEQRES and ATOM records:

>d2oqyh2 c.1.11.0 (H:123-374) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlsw

Timeline for d2oqyh2:

• d2oqyh2 is new in SCOPe 2.04-stable
  
• d2oqyh2 appears in SCOPe 2.05
  
• d2oqyh2 appears in the current release, SCOPe 2.08