SCOP 1.67: Domain d1ukrb_: 1ukr B:

Lineage for d1ukrb_ (1ukr B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (15 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Aspergillus niger [49987] (1 PDB entry)

8. Domain d1ukrb_: 1ukr B: [24337]

Details for d1ukrb_

PDB Entry: 1ukr, 2.4 Å

PDB Description: structure of endo-1,4-beta-xylanase c

SCOP Domain Sequences for d1ukrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ukrb_ b.29.1.11 (B:) Xylanase II {Aspergillus niger}
ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
s

Timeline for d1ukrb_:

• d1ukrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ukrb_ appears in SCOP 1.65
  
• d1ukrb_ appears in SCOP 1.69
  
• d1ukrb_ appears in the current release, SCOPe 2.08