SCOPe 2.08: Domain d2oqyf2: 2oqy F:123-374

Lineage for d2oqyf2 (2oqy F:123-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:182710] [255531] (3 PDB entries)

8. Domain d2oqyf2: 2oqy F:123-374 [243369]
   Other proteins in same PDB: d2oqya1, d2oqyb1, d2oqyc1, d2oqyd1, d2oqye1, d2oqyf1, d2oqyg1, d2oqyh1
   automated match to d3sjna2
   complexed with mg

Details for d2oqyf2

PDB Entry: 2oqy, 2 Å

PDB Description: the crystal structure of muconate cycloisomerase from oceanobacillus iheyensis

PDB Compounds: (F:) Muconate cycloisomerase

SCOPe Domain Sequences for d2oqyf2:

Sequence; same for both SEQRES and ATOM records:

>d2oqyf2 c.1.11.0 (F:123-374) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlsw

Timeline for d2oqyf2:

• d2oqyf2 first appeared in SCOPe 2.04
  
• d2oqyf2 appears in SCOPe 2.07