| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Oceanobacillus iheyensis [TaxId:182710] [255530] (1 PDB entry) |
| Domain d2oqye1: 2oqy E:1-122 [243366] Other proteins in same PDB: d2oqya2, d2oqyb2, d2oqyc2, d2oqyd2, d2oqye2, d2oqyf2, d2oqyg2, d2oqyh2 automated match to d3sjna1 complexed with mg |
PDB Entry: 2oqy (more details), 2 Å
SCOPe Domain Sequences for d2oqye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqye1 d.54.1.0 (E:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg
Timeline for d2oqye1: