| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (74 species) not a true protein |
| Species Oceanobacillus iheyensis [TaxId:182710] [255531] (3 PDB entries) |
| Domain d2oqyc2: 2oqy C:123-374 [243363] Other proteins in same PDB: d2oqya1, d2oqyb1, d2oqyc1, d2oqyd1, d2oqye1, d2oqyf1, d2oqyg1, d2oqyh1 automated match to d3sjna2 complexed with mg |
PDB Entry: 2oqy (more details), 2 Å
SCOPe Domain Sequences for d2oqyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqyc2 c.1.11.0 (C:123-374) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlsw
Timeline for d2oqyc2: