SCOPe 2.05: Domain d2oqyc1: 2oqy C:1-122

Lineage for d2oqyc1 (2oqy C:1-122)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries)

8. Domain d2oqyc1: 2oqy C:1-122 [243362]
   Other proteins in same PDB: d2oqya2, d2oqyb2, d2oqyc2, d2oqyd2, d2oqye2, d2oqyf2, d2oqyg2, d2oqyh2
   automated match to d3sjna1
   complexed with mg

Details for d2oqyc1

PDB Entry: 2oqy, 2 Å

PDB Description: the crystal structure of muconate cycloisomerase from oceanobacillus iheyensis

PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d2oqyc1:

Sequence; same for both SEQRES and ATOM records:

>d2oqyc1 d.54.1.0 (C:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

Timeline for d2oqyc1:

• d2oqyc1 first appeared in SCOPe 2.04
  
• d2oqyc1 appears in SCOPe 2.06
  
• d2oqyc1 appears in the current release, SCOPe 2.08