Lineage for d2oqya1 (2oqy A:1-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555272Species Oceanobacillus iheyensis [TaxId:182710] [255530] (3 PDB entries)
  8. 2555275Domain d2oqya1: 2oqy A:1-122 [243358]
    Other proteins in same PDB: d2oqya2, d2oqyb2, d2oqyc2, d2oqyd2, d2oqye2, d2oqyf2, d2oqyg2, d2oqyh2
    automated match to d3sjna1
    complexed with mg

Details for d2oqya1

PDB Entry: 2oqy (more details), 2 Å

PDB Description: the crystal structure of muconate cycloisomerase from oceanobacillus iheyensis
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d2oqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqya1 d.54.1.0 (A:1-122) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
gg

SCOPe Domain Coordinates for d2oqya1:

Click to download the PDB-style file with coordinates for d2oqya1.
(The format of our PDB-style files is described here.)

Timeline for d2oqya1: