Lineage for d2om5a4 (2om5 A:296-384)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369532Domain d2om5a4: 2om5 A:296-384 [243352]
    automated match to d1cs6a4

Details for d2om5a4

PDB Entry: 2om5 (more details), 3.07 Å

PDB Description: n-terminal fragment of human tax1
PDB Compounds: (A:) Contactin 2

SCOPe Domain Sequences for d2om5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2om5a4 b.1.1.0 (A:296-384) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpewlkvisdteadigsnlrwgcaaagkprptvrwlrngeplasqnrvevlagdlrfskl
sledsgmyqcvaenkhgtiyasaelavqa

SCOPe Domain Coordinates for d2om5a4:

Click to download the PDB-style file with coordinates for d2om5a4.
(The format of our PDB-style files is described here.)

Timeline for d2om5a4: