SCOPe 2.04: Domain d2om5a3: 2om5 A:205-295

Lineage for d2om5a3 (2om5 A:205-295)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2om5a3: 2om5 A:205-295 [243351]
   automated match to d1cs6a3

Details for d2om5a3

PDB Entry: 2om5, 3.07 Å

PDB Description: n-terminal fragment of human tax1

PDB Compounds: (A:) Contactin 2

SCOPe Domain Sequences for d2om5a3:

Sequence, based on SEQRES records:

>d2om5a3 b.1.1.0 (A:205-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfapsikarfpaetyalvgqqvtlecfafgnpvprikwrkvdgslspqwttaeptlqip
svsfedegtyeceaenskgrdtvqgriivqa

Sequence, based on observed residues (ATOM records):

>d2om5a3 b.1.1.0 (A:205-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfapsikarfpaetyalvgqqvtlecfafgnpvprikwrkvaeptlqipsvsfedegty
eceaenskgrdtvqgriivqa

Timeline for d2om5a3:

• d2om5a3 is new in SCOPe 2.04-stable
  
• d2om5a3 appears in SCOPe 2.05
  
• d2om5a3 appears in the current release, SCOPe 2.08