| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Thermomyces lanuginosus [TaxId:5541] [49986] (1 PDB entry) |
| Domain d1ynaa_: 1yna A: [24335] |
PDB Entry: 1yna (more details), 1.55 Å
SCOPe Domain Sequences for d1ynaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynaa_ b.29.1.11 (A:) Xylanase II {Thermomyces lanuginosus [TaxId: 5541]}
ettpnsegwhdgyyyswwsdggaqatytnleggtyeiswgdggnlvggkgwnpglnarai
hfegvyqpngnsylavygwtrnplveyyivenfgtydpssgatdlgtvecdgsiyrlgkt
trvnapsidgtqtfdqywsvrqdkrtsgtvqtgchfdawaraglnvngdhyyqivategy
fssgyaritvadvg
Timeline for d1ynaa_: