Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (2 families) active form is a dimer |
Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
Protein automated matches [190596] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255528] (1 PDB entry) |
Domain d2okvb_: 2okv B: [243346] automated match to d3ko7b_ complexed with mg |
PDB Entry: 2okv (more details), 2 Å
SCOPe Domain Sequences for d2okvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2okvb_ c.110.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkavvqrvtrasvtvggeqisaigrgicvllgisledtqkelehmvrkilnlrvfedesg khwsksvmdkqyeilcvsqftlqcvlkgnkpdfhlampteqaegfynsfleqlrktyrpe likdgkfgaymqvhiqndgpvtielespap
Timeline for d2okvb_: