SCOPe 2.04: Domain d2okvb_: 2okv B:

Lineage for d2okvb_ (2okv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (2 families)
   active form is a dimer

5. Family c.110.1.0: automated matches [191422] (1 protein)
   not a true family

6. Protein automated matches [190596] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255528] (1 PDB entry)

8. Domain d2okvb_: 2okv B: [243346]
   automated match to d3ko7b_
   complexed with mg

Details for d2okvb_

PDB Entry: 2okv, 2 Å

PDB Description: c-Myc DNA Unwinding Element Binding Protein

PDB Compounds: (B:) Probable D-tyrosyl-tRNA(Tyr) deacylase 1

SCOPe Domain Sequences for d2okvb_:

Sequence; same for both SEQRES and ATOM records:

>d2okvb_ c.110.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkavvqrvtrasvtvggeqisaigrgicvllgisledtqkelehmvrkilnlrvfedesg
khwsksvmdkqyeilcvsqftlqcvlkgnkpdfhlampteqaegfynsfleqlrktyrpe
likdgkfgaymqvhiqndgpvtielespap

Timeline for d2okvb_:

• d2okvb_ is new in SCOPe 2.04-stable
  
• d2okvb_ appears in SCOPe 2.05
  
• d2okvb_ appears in the current release, SCOPe 2.08