Lineage for d2okva_ (2okv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920897Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2920898Protein automated matches [190596] (6 species)
    not a true protein
  7. 2920916Species Human (Homo sapiens) [TaxId:9606] [255528] (1 PDB entry)
  8. 2920917Domain d2okva_: 2okv A: [243345]
    automated match to d3ko7b_
    complexed with mg

Details for d2okva_

PDB Entry: 2okv (more details), 2 Å

PDB Description: c-Myc DNA Unwinding Element Binding Protein
PDB Compounds: (A:) Probable D-tyrosyl-tRNA(Tyr) deacylase 1

SCOPe Domain Sequences for d2okva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2okva_ c.110.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkavvqrvtrasvtvggeqisaigrgicvllgisledtqkelehmvrkilnlrvfedesg
khwsksvmdkqyeilcvsqftlqcvlkgnkpdfhlampteqaegfynsfleqlrktyrpe
likdgkfgaymqvhiqndgpvtielespa

SCOPe Domain Coordinates for d2okva_:

Click to download the PDB-style file with coordinates for d2okva_.
(The format of our PDB-style files is described here.)

Timeline for d2okva_: