SCOPe 2.02: Domain d1refb_: 1ref B:

Lineage for d1refb_ (1ref B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (11 PDB entries)

8. Domain d1refb_: 1ref B: [24334]
   complexed with bez, c3x

Details for d1refb_

PDB Entry: 1ref, 1.8 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 2,3-epoxypropyl-beta-d-xyloside

PDB Compounds: (B:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1refb_:

Sequence; same for both SEQRES and ATOM records:

>d1refb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1refb_:

• d1refb_ first appeared (with stable ids) in SCOP 1.55
  
• d1refb_ appears in SCOPe 2.01
  
• d1refb_ appears in SCOPe 2.03
  
• d1refb_ appears in the current release, SCOPe 2.08, called d1refb1