Lineage for d2ogeb_ (2oge B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149337Species Streptomyces venezuelae [TaxId:54571] [255527] (2 PDB entries)
  8. 2149339Domain d2ogeb_: 2oge B: [243335]
    automated match to d3uwca_
    complexed with cl, edo, na

Details for d2ogeb_

PDB Entry: 2oge (more details), 2.05 Å

PDB Description: x-ray structure of S. venezuelae DesV in its internal aldimine form
PDB Compounds: (B:) Transaminase

SCOPe Domain Sequences for d2ogeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogeb_ c.67.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
prvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvnsg
mdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllveka
itprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaaf
sfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavlr
irlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrshl
dargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvid
avrewaerv

SCOPe Domain Coordinates for d2ogeb_:

Click to download the PDB-style file with coordinates for d2ogeb_.
(The format of our PDB-style files is described here.)

Timeline for d2ogeb_: