Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Streptomyces venezuelae [TaxId:54571] [255527] (2 PDB entries) |
Domain d2ogea_: 2oge A: [243334] automated match to d3uwca_ complexed with cl, edo, na |
PDB Entry: 2oge (more details), 2.05 Å
SCOPe Domain Sequences for d2ogea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ogea_ c.67.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]} prvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvnsg mdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllveka itprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaaf sfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavlr irlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrshl dargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvid avrewaer
Timeline for d2ogea_: