SCOPe 2.04: Domain d2ogea_: 2oge A:

Lineage for d2ogea_ (2oge A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Streptomyces venezuelae [TaxId:54571] [255527] (2 PDB entries)

8. Domain d2ogea_: 2oge A: [243334]
   automated match to d3uwca_
   complexed with cl, edo, na

Details for d2ogea_

PDB Entry: 2oge, 2.05 Å

PDB Description: x-ray structure of S. venezuelae DesV in its internal aldimine form

PDB Compounds: (A:) Transaminase

SCOPe Domain Sequences for d2ogea_:

Sequence; same for both SEQRES and ATOM records:

>d2ogea_ c.67.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
prvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvnsg
mdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllveka
itprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaaf
sfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavlr
irlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrshl
dargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvid
avrewaer

Timeline for d2ogea_:

• d2ogea_ is new in SCOPe 2.04-stable
  
• d2ogea_ appears in SCOPe 2.05
  
• d2ogea_ appears in the current release, SCOPe 2.08