Lineage for d1refa_ (1ref A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295061Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 295092Protein Xylanase II [49979] (15 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 295146Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)
  8. 295157Domain d1refa_: 1ref A: [24333]

Details for d1refa_

PDB Entry: 1ref (more details), 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 2,3-epoxypropyl-beta-d-xyloside

SCOP Domain Sequences for d1refa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1refa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d1refa_:

Click to download the PDB-style file with coordinates for d1refa_.
(The format of our PDB-style files is described here.)

Timeline for d1refa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1refb_