SCOPe 2.05: Domain d2ogab_: 2oga B:

Lineage for d2ogab_ (2oga B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Streptomyces venezuelae [TaxId:54571] [255527] (2 PDB entries)

8. Domain d2ogab_: 2oga B: [243329]
   automated match to d3uwca_
   complexed with cl, edo, na, pgu

Details for d2ogab_

PDB Entry: 2oga, 2.05 Å

PDB Description: X-ray crystal structure of S. venezuelae DesV in complex with ketimine intermediate

PDB Compounds: (B:) Transaminase

SCOPe Domain Sequences for d2ogab_:

Sequence; same for both SEQRES and ATOM records:

>d2ogab_ c.67.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
tprvpfldlkaayeelraetdaaiarvldsgryllgpelegfeaefaaycetdhavgvns
gmdalqlalrglgigpgdevivpshtyiaswlavsatgatpvpvephedhptldpllvek
aitprtrallpvhlyghpadmdalreladrhglhivedaaqahgaryrgrrigagssvaa
fsfypgknlgcfgdggavvtgdpelaerlrmlrnygsrqkyshetkgtnsrldemqaavl
rirlahldswngrrsalaaeylsglaglpgiglpvtapdtdpvwhlftvrterrdelrsh
ldargidtlthypvpvhlspayageappegslpraesfarqvlslpigphlerpqalrvi
davrewaerv

Timeline for d2ogab_:

• d2ogab_ first appeared in SCOPe 2.04
  
• d2ogab_ appears in SCOPe 2.06
  
• d2ogab_ appears in the current release, SCOPe 2.08