Lineage for d2ofna1 (2ofn A:1-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548747Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2548748Protein automated matches [191162] (29 species)
    not a true protein
  7. 2548870Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)
  8. 2548878Domain d2ofna1: 2ofn A:1-127 [243325]
    Other proteins in same PDB: d2ofna2
    automated match to d3o5ea_

Details for d2ofna1

PDB Entry: 2ofn (more details)

PDB Description: solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d2ofna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofna1 d.26.1.0 (A:1-127) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtteqefekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfd
rnvpfkfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfei
ellsfre

SCOPe Domain Coordinates for d2ofna1:

Click to download the PDB-style file with coordinates for d2ofna1.
(The format of our PDB-style files is described here.)

Timeline for d2ofna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofna2