Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (23 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries) |
Domain d2ofna_: 2ofn A: [243325] automated match to d3o5ea_ |
PDB Entry: 2ofn (more details)
SCOPe Domain Sequences for d2ofna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofna_ d.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} mtteqefekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfd rnvpfkfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfei ellsfrelehhhhhh
Timeline for d2ofna_: