Lineage for d2ofna_ (2ofn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1900227Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1900228Protein automated matches [191162] (23 species)
    not a true protein
  7. 1900294Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)
  8. 1900302Domain d2ofna_: 2ofn A: [243325]
    automated match to d3o5ea_

Details for d2ofna_

PDB Entry: 2ofn (more details)

PDB Description: solution structure of fk506-binding domain (fkbd)of fkbp35 from plasmodium falciparum
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase, putative

SCOPe Domain Sequences for d2ofna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofna_ d.26.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtteqefekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfd
rnvpfkfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfei
ellsfrelehhhhhh

SCOPe Domain Coordinates for d2ofna_:

Click to download the PDB-style file with coordinates for d2ofna_.
(The format of our PDB-style files is described here.)

Timeline for d2ofna_: