![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries) |
![]() | Domain d2ofna1: 2ofn A:1-127 [243325] Other proteins in same PDB: d2ofna2 automated match to d3o5ea_ |
PDB Entry: 2ofn (more details)
SCOPe Domain Sequences for d2ofna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofna1 d.26.1.0 (A:1-127) automated matches {Plasmodium falciparum [TaxId: 36329]} mtteqefekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfd rnvpfkfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfei ellsfre
Timeline for d2ofna1: