Lineage for d2ofhx_ (2ofh X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196990Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2196991Protein automated matches [191063] (8 species)
    not a true protein
  7. 2197016Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries)
  8. 2197019Domain d2ofhx_: 2ofh X: [243324]
    automated match to d1kvja_

Details for d2ofhx_

PDB Entry: 2ofh (more details)

PDB Description: Solution structure of the n-terminal domain of the zinc(II) ATPase ziaa in its apo form
PDB Compounds: (X:) Zinc-transporting ATPase

SCOPe Domain Sequences for d2ofhx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofhx_ d.58.17.0 (X:) automated matches {Synechocystis sp. [TaxId: 1148]}
plktqqmqvggmdctscklkiegslerlkgvaeasvtvatgrltvtydpkqvseitiqer
iaalgytlaep

SCOPe Domain Coordinates for d2ofhx_:

Click to download the PDB-style file with coordinates for d2ofhx_.
(The format of our PDB-style files is described here.)

Timeline for d2ofhx_: