![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (9 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries) |
![]() | Domain d2ofhx_: 2ofh X: [243324] automated match to d1kvja_ |
PDB Entry: 2ofh (more details)
SCOPe Domain Sequences for d2ofhx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ofhx_ d.58.17.0 (X:) automated matches {Synechocystis sp. [TaxId: 1148]} plktqqmqvggmdctscklkiegslerlkgvaeasvtvatgrltvtydpkqvseitiqer iaalgytlaep
Timeline for d2ofhx_: