Lineage for d1reeb_ (1ree B:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) 
Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries) 
Domain d1reeb_: 1ree B: [24332]
Details for d1reeb_
PDB Entry: 1ree (more details), 1.6 Å
PDB Description: endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside
SCOP Domain Sequences for d1reeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1reeb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs
SCOP Domain Coordinates for d1reeb_:
Click to download the PDB-style file with coordinates for d1reeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1reeb_:
- d1reeb_ first appeared (with stable ids) in SCOP 1.55
- d1reeb_ appears in SCOP 1.59
- d1reeb_ appears in the current release, SCOPe 2.08, called d1reeb1
View in 3D
