![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
![]() | Family d.48.1.0: automated matches [227236] (1 protein) not a true family |
![]() | Protein automated matches [226990] (2 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [255525] (3 PDB entries) |
![]() | Domain d2odna2: 2odn A:271-330 [243317] Other proteins in same PDB: d2odna1 automated match to d2zrma2 protein/DNA complex; complexed with dtp |
PDB Entry: 2odn (more details), 3.1 Å
SCOPe Domain Sequences for d2odna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odna2 d.48.1.0 (A:271-330) automated matches {Mycobacterium smegmatis [TaxId: 1772]} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
Timeline for d2odna2: