Lineage for d2obva2 (2obv A:126-251)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669649Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1669650Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1669749Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1669750Protein automated matches [254617] (8 species)
    not a true protein
  7. 1669787Species Human (Homo sapiens) [TaxId:9606] [255522] (2 PDB entries)
  8. 1669789Domain d2obva2: 2obv A:126-251 [243312]
    automated match to d2p02a2
    complexed with na, pg4, sam

Details for d2obva2

PDB Entry: 2obv (more details), 2.05 Å

PDB Description: crystal structure of the human s-adenosylmethionine synthetase 1 in complex with the product
PDB Compounds: (A:) S-adenosylmethionine synthetase isoform type-1

SCOPe Domain Sequences for d2obva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obva2 d.130.1.0 (A:126-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
needvgagdqglmfgyatdeteecmpltiilahklnarmadlrrsgllpwlrpdsktqvt
vqymqdngavipvrihtivisvqhneditleemrralkeqviravvpakyldedtvyhlq
psgrfv

SCOPe Domain Coordinates for d2obva2:

Click to download the PDB-style file with coordinates for d2obva2.
(The format of our PDB-style files is described here.)

Timeline for d2obva2: