SCOPe 2.05: Domain d2obva1: 2obv A:-3-125

Lineage for d2obva1 (2obv A:-3-125)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255522] (2 PDB entries)

8. Domain d2obva1: 2obv A:-3-125 [243311]
   automated match to d2p02a1
   complexed with na, pg4, sam

Details for d2obva1

PDB Entry: 2obv, 2.05 Å

PDB Description: crystal structure of the human s-adenosylmethionine synthetase 1 in complex with the product

PDB Compounds: (A:) S-adenosylmethionine synthetase isoform type-1

SCOPe Domain Sequences for d2obva1:

Sequence; same for both SEQRES and ATOM records:

>d2obva1 d.130.1.0 (A:-3-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqsmgvfmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgei
tsmamvdyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaqcvhldr

Timeline for d2obva1:

• d2obva1 first appeared in SCOPe 2.04
  
• d2obva1 appears in SCOPe 2.06
  
• d2obva1 appears in the current release, SCOPe 2.08