Lineage for d1reea_ (1ree A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556586Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 556625Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 556683Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)
  8. 556692Domain d1reea_: 1ree A: [24331]

Details for d1reea_

PDB Entry: 1ree (more details), 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside

SCOP Domain Sequences for d1reea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reea_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d1reea_:

Click to download the PDB-style file with coordinates for d1reea_.
(The format of our PDB-style files is described here.)

Timeline for d1reea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1reeb_