Lineage for d1reea_ (1ree A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (11 species) 
Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries) 
Domain d1reea_: 1ree A: [24331]
Details for d1reea_
PDB Entry: 1ree (more details), 1.6 Å
PDB Description: endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside
SCOP Domain Sequences for d1reea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1reea_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs
SCOP Domain Coordinates for d1reea_:
Click to download the PDB-style file with coordinates for d1reea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1reea_:
- d1reea_ appears in SCOP 1.57
- d1reea_ appears in the current release, SCOPe 2.08, called d1reea1
View in 3D
