SCOPe 2.08: Domain d1reea1: 1ree A:2-190

Lineage for d1reea1 (1ree A:2-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)

8. Domain d1reea1: 1ree A:2-190 [24331]
   Other proteins in same PDB: d1reea2, d1reeb2
   complexed with 07e, bez

Details for d1reea1

PDB Entry: 1ree, 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside

PDB Compounds: (A:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1reea1:

Sequence; same for both SEQRES and ATOM records:

>d1reea1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d1reea1:

• d1reea1 first appeared (with stable ids) in SCOP 1.55, called d1reea_
  
• d1reea1 appears in SCOPe 2.07