SCOPe 2.06: Domain d2oaeb1: 2oae B:38-509

Lineage for d2oaeb1 (2oae B:38-509)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225089] (7 PDB entries)

8. Domain d2oaeb1: 2oae B:38-509 [243309]
   Other proteins in same PDB: d2oaea2, d2oaeb2
   automated match to d2gbca1
   complexed with ail, so4

Details for d2oaeb1

PDB Entry: 2oae, 3 Å

PDB Description: crystal structure of rat dipeptidyl peptidase (dppiv) with thiazole- based peptide mimetic #31

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2oaeb1:

Sequence; same for both SEQRES and ATOM records:

>d2oaeb1 b.70.3.1 (B:38-509) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rrtytladylkntfrvksyslrwvsdseylykqennillfnaehgnssiflenstfeifg
dsisdysvspdrlfvlleynyvkqwrhsytasysiydlnkrqliteekipnntqwitwsq
eghklayvwkndiyvkiephlpshritstgkenvifngindwvyeeeifgaysalwwspn
gtflayaqfndtgvplieysfysdeslqypktvwipypkagavnptvkffivntdslsst
tttipmqitapasvttgdhylcdvawvsedrislqwlrriqnysvmaicdydkttlvwnc
pttqehietsatgwcgrfrpaephftsdgssfykivsdkdgykhicqfqkdrkpeqvctf
itkgawevisiealtsdylyyisneykempggrnlykiqltdhtnkkclscdlnpercqy
ysvslskeakyyqlgcrgpglplytlhrstdqkelrvlednsaldkmlqdvq

Timeline for d2oaeb1:

• d2oaeb1 first appeared in SCOPe 2.04
  
• d2oaeb1 appears in SCOPe 2.05
  
• d2oaeb1 appears in SCOPe 2.07
  
• d2oaeb1 appears in the current release, SCOPe 2.08