SCOPe 2.04: Domain d2oaea2: 2oae A:510-767

Lineage for d2oaea2 (2oae A:510-767)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (8 PDB entries)

8. Domain d2oaea2: 2oae A:510-767 [243308]
   Other proteins in same PDB: d2oaea1, d2oaeb1
   automated match to d4ffvb2
   complexed with ail, so4

Details for d2oaea2

PDB Entry: 2oae, 3 Å

PDB Description: crystal structure of rat dipeptidyl peptidase (dppiv) with thiazole- based peptide mimetic #31

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2oaea2:

Sequence; same for both SEQRES and ATOM records:

>d2oaea2 c.69.1.0 (A:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfslr

Timeline for d2oaea2:

• d2oaea2 is new in SCOPe 2.04-stable
  
• d2oaea2 appears in SCOPe 2.05
  
• d2oaea2 appears in the current release, SCOPe 2.08