Lineage for d2oaea2 (2oae A:510-767)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2476970Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries)
  8. 2476985Domain d2oaea2: 2oae A:510-767 [243308]
    Other proteins in same PDB: d2oaea1, d2oaeb1
    automated match to d4ffvb2
    complexed with ail, so4

Details for d2oaea2

PDB Entry: 2oae (more details), 3 Å

PDB Description: crystal structure of rat dipeptidyl peptidase (dppiv) with thiazole- based peptide mimetic #31
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2oaea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oaea2 c.69.1.0 (A:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfslr

SCOPe Domain Coordinates for d2oaea2:

Click to download the PDB-style file with coordinates for d2oaea2.
(The format of our PDB-style files is described here.)

Timeline for d2oaea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oaea1