Lineage for d2o8ha_ (2o8h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737540Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (12 PDB entries)
  8. 2737550Domain d2o8ha_: 2o8h A: [243305]
    automated match to d4lm1a_
    complexed with 227, mg, zn

Details for d2o8ha_

PDB Entry: 2o8h (more details), 1.8 Å

PDB Description: crystal structure of the catalytic domain of rat phosphodiesterase 10a
PDB Compounds: (A:) Phosphodiesterase-10A

SCOPe Domain Sequences for d2o8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o8ha_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lparicrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrvp
yhnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhpla
alyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrk
qleemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdem
kklgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqwe
kvirgee

SCOPe Domain Coordinates for d2o8ha_:

Click to download the PDB-style file with coordinates for d2o8ha_.
(The format of our PDB-style files is described here.)

Timeline for d2o8ha_: