Lineage for d1redb_ (1red B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534192Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1534237Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1534341Species Trichoderma reesei, xynII [TaxId:51453] [49985] (12 PDB entries)
  8. 1534352Domain d1redb_: 1red B: [24330]
    complexed with bez, c5x

Details for d1redb_

PDB Entry: 1red (more details), 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 4,5-epoxypentyl-beta-d-xyloside
PDB Compounds: (B:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1redb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1redb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d1redb_:

Click to download the PDB-style file with coordinates for d1redb_.
(The format of our PDB-style files is described here.)

Timeline for d1redb_: